Protein Info for MPMX19_00575 in Azospirillum sp. SherDot2
Annotation: 4-hydroxybenzoate octaprenyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to PGT2_LITER: 4-hydroxybenzoate geranyltransferase 2 (PGT-2) from Lithospermum erythrorhizon
KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 93% identity to azl:AZL_007570)Predicted SEED Role
"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)
MetaCyc Pathways
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
- ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
- ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
- plastoquinol-9 biosynthesis II (1/5 steps found)
- ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
- ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
- ubiquinol-10 biosynthesis (late decarboxylation) (3/9 steps found)
- ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
- superpathway of chorismate metabolism (38/59 steps found)
- ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
- ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
- superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
KEGG Metabolic Maps
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Methionine metabolism
- Porphyrin and chlorophyll metabolism
- Riboflavin metabolism
- Terpenoid biosynthesis
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.-
Use Curated BLAST to search for 2.5.1.- or 2.5.1.39
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (315 amino acids)
>MPMX19_00575 4-hydroxybenzoate octaprenyltransferase (Azospirillum sp. SherDot2) MPTASTGPTLPESGFTDIRQDGWIARKLPPRVRPYVTLARLDRPIGTWLLLFPCWWSVAL AMPQPFRDWPTLLWLMALFGVGAVLMRGAGCTVNDILDRKFDAMVERTRSRPIPSGQVTV RQALAFLVAQLLVSLLILVQLGTTAIGLGVLSLLLVFTYPLMKRITWWPQAFLGLTFNWG ALMGWATVQNDVGWPALALYVTGVAWTLGYDTIYAHQDKEDDARIGVKSTALRLGDQSKI WIYGFYTLTYVGIGIAGRLAGLGGLFLPVLSLAALQLAWQVATWRPDDQGDCLDKFKSNR WFGWLVLAAILAGKI