Protein Info for MMJJ_RS09155 in Methanococcus maripaludis JJ

Annotation: RluA family pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR00005: pseudouridine synthase, RluA family" amino acids 17 to 297 (281 residues), 239 bits, see alignment E=3.5e-75 PF00849: PseudoU_synth_2" amino acids 90 to 240 (151 residues), 112.9 bits, see alignment E=8.2e-37

Best Hits

KEGG orthology group: K06180, ribosomal large subunit pseudouridine synthase D [EC: 5.4.99.12] (inferred from 91% identity to mmz:MmarC7_0252)

Predicted SEED Role

"Similar to ribosomal large subunit pseudouridine synthase D, group RluD10"

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.12

Use Curated BLAST to search for 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>MMJJ_RS09155 RluA family pseudouridine synthase (Methanococcus maripaludis JJ)
MESQKKILKLTVDSKIVGNKLIDVLKDNFELSNKMIKKFDKENKIFVNSKNISLKSKLKE
NETVYVEIDCGINTIDPENLALNIIYEDDDLLIVDKPKNMVVHPTKNVLSKTLANAVSNH
QKINNQNYKIRFVNRLDMDTTGLLIIAKDPYSHQRLAKQMDEGILEKIYIAVVNGHLDLK
EGIIEDSIDLNDDGIKRELSNVGKISKTKYKVIEELKNASILEIKLLTGRTHQIRVHLSS
TGNYIIGDTLYGEISNLIERQALHSYILRFIHPITKEKMEFSSKLPDDMENLIKNLKE