Protein Info for MMJJ_RS06320 in Methanococcus maripaludis JJ

Annotation: tetrahydromethanopterin S-methyltransferase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 transmembrane" amino acids 77 to 100 (24 residues), see Phobius details PF05440: MtrB" amino acids 3 to 96 (94 residues), 125.2 bits, see alignment E=6e-41 TIGR04166: tetrahydromethanopterin S-methyltransferase, subunit B" amino acids 3 to 95 (93 residues), 120 bits, see alignment E=2.1e-39

Best Hits

Swiss-Prot: 100% identical to MTRB_METMP: Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00578, tetrahydromethanopterin S-methyltransferase subunit B [EC: 2.1.1.86] (inferred from 100% identity to mmp:MMP1563)

Predicted SEED Role

"N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit B (EC 2.1.1.86)" in subsystem Methanogenesis (EC 2.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.86

Use Curated BLAST to search for 2.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>MMJJ_RS06320 tetrahydromethanopterin S-methyltransferase subunit B (Methanococcus maripaludis JJ)
MDIVKVCPELHIVMDVDSGLIAEMRKDILVVDLHPVEDEINKLAQYAKALENSLDPRNTP
MKAYAGREGTYKLAGMFQGMFFGFWVTMAVLVLVTILAVKMNLSLIGL