Protein Info for MMJJ_RS06010 in Methanococcus maripaludis JJ

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details

Best Hits

Swiss-Prot: 54% identical to Y1308_METJA: Uncharacterized protein MJ1308 (MJ1308) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K14116, energy-converting hydrogenase B subunit G (inferred from 97% identity to mmx:MmarC6_1043)

Predicted SEED Role

"Energy conserving hydrogenase Ehb protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>MMJJ_RS06010 hypothetical protein (Methanococcus maripaludis JJ)
MTYGDFKKEMDEQNHGDGISVGAVLTAEFTLYGFLILSLFLIFRVYGNLLMVLIGLSVIG
LAYSWMPLIFKFQKENSNDVNNQLFWLSMFSGILTMVIYFAR