Protein Info for MMJJ_RS05525 in Methanococcus maripaludis JJ

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00025: Arf
  • amino acids 3 to 154 (152 residues), 35.1 bits, E=3.3e-12
• TIGR00231: small GTP-binding protein domain
  • amino acids 3 to 130 (128 residues), 76.1 bits, E=1.4e-25
• PF02421: FeoB_N
  • amino acids 6 to 153 (148 residues), 28.5 bits, E=3.6e-10
• PF00071: Ras
  • amino acids 6 to 117 (112 residues), 41.7 bits, E=3.2e-14
• PF08477: Roc
  • amino acids 6 to 113 (108 residues), 40.4 bits, E=1.1e-13
• PF01926: MMR_HSR1
  • amino acids 6 to 111 (106 residues), 55.5 bits, E=2e-18
• PF03029: ATP_bind_1
  • amino acids 33 to 133 (101 residues), 28.8 bits, E=3.9e-10
• PF00009: GTP_EFTU
  • amino acids 33 to 154 (122 residues), 55.5 bits, E=2.1e-18

Best Hits

KEGG orthology group: K06945, (no description) (inferred from 99% identity to mmp:MMP1715)

Predicted SEED Role

"M. jannaschii predicted coding region MJ1339"

Protein Sequence (157 amino acids)

>MMJJ_RS05525 GTP-binding protein (Methanococcus maripaludis JJ)
MVKELKIVVMGSEDVGKTTLMENLIKNVGKVEHNGTTVAIDYGRIEMDDKKFHFFGTPGQ
ERFGFMREIAVEGADYALLVLDATVGLRKVDNDIINLLSTKNIPFSVFINKMDICNESNA
VEIINNLNGFIESSNIVTGSIYRKEGLSEIMDQLKII