Protein Info for MMJJ_RS01865 in Methanococcus maripaludis JJ

Annotation: peptidyl-tRNA hydrolase Pth2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF01981: PTH2" amino acids 2 to 116 (115 residues), 149.3 bits, see alignment E=2.6e-48 TIGR00283: peptidyl-tRNA hydrolase" amino acids 4 to 116 (113 residues), 165.5 bits, see alignment E=2.4e-53

Best Hits

Swiss-Prot: 100% identical to PTH_METM6: Peptidyl-tRNA hydrolase (pth) from Methanococcus maripaludis (strain C6 / ATCC BAA-1332)

KEGG orthology group: K04794, peptidyl-tRNA hydrolase, PTH2 family [EC: 3.1.1.29] (inferred from 98% identity to mmp:MMP0609)

Predicted SEED Role

"Peptidyl-tRNA hydrolase, archaeal type (EC 3.1.1.29)" in subsystem ZZ gjo need homes (EC 3.1.1.29)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>MMJJ_RS01865 peptidyl-tRNA hydrolase Pth2 (Methanococcus maripaludis JJ)
MYEQAIVIRNDLKMGKGKMAAQACHASLQAFLHAQKISSSAVSGWMNEGQKKVVLKVNSE
KELLEIFKNVNIEGLPCSLIRDAGRTQIEPGSLTAVGIGPEKEEKISKVTKDLKLL