Protein Info for MMJJ_RS00385 in Methanococcus maripaludis JJ

Annotation: TIGR00454 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00454: TIGR00454 family protein
  • amino acids 1 to 196 (196 residues), 183.2 bits, E=2.3e-58
• PF00483: NTP_transferase
  • amino acids 3 to 107 (105 residues), 43.4 bits, E=4.9e-15
• PF12804: NTP_transf_3
  • amino acids 3 to 122 (120 residues), 45.8 bits, E=1.2e-15
• PF02348: CTP_transf_3
  • amino acids 4 to 122 (119 residues), 25.8 bits, E=1.3e-09

Best Hits

Swiss-Prot: 46% identical to COBY_METJA: Adenosylcobinamide-phosphate guanylyltransferase (cobY) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0915)

Predicted SEED Role

"Predicted adenosylcobinamide-phosphate guanylyltransferase CobY (EC 2.7.7.62)" in subsystem Coenzyme B12 biosynthesis (EC 2.7.7.62)

MetaCyc Pathways

• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (24/33 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (4/6 steps found)
• adenosylcobinamide-GDP salvage from assorted adenosylcobamides (1/2 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (6/9 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (5/8 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (3/6 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (2/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.62

Protein Sequence (202 amino acids)

>MMJJ_RS00385 TIGR00454 family protein (Methanococcus maripaludis JJ)
MDALIMAGGKGTRLKENVEKPILNICEKPMIDYVIDSLLNSKIEKIYVAVSIHTPKTKEY
LEKKYRLDRNYNPKIDIICTSGTNYVDDLNECMEFFKEPFLILSSDIPTIKPKVINSIIQ
DYLFVNNSCNRIESFCVVTKDDDYVGTPSINMGGYIPLGINILTPKHGEQTEILHVIKDI
IVNVNTLSDKKLVETLINKVIE