Protein Info for MIT1002_00425 in Alteromonas macleodii MIT1002

Annotation: Cation efflux system protein CzcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 65 to 370 (306 residues), 186.6 bits, see alignment E=2.9e-59 PF16576: HlyD_D23" amino acids 73 to 284 (212 residues), 53.9 bits, see alignment E=3.1e-18 PF13533: Biotin_lipoyl_2" amino acids 78 to 123 (46 residues), 37 bits, see alignment 4.5e-13 PF13437: HlyD_3" amino acids 186 to 282 (97 residues), 31.9 bits, see alignment E=4e-11

Best Hits

KEGG orthology group: None (inferred from 86% identity to amc:MADE_00487)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>MIT1002_00425 Cation efflux system protein CzcB (Alteromonas macleodii MIT1002)
MTAATTPSKSGKLSLIIAIAVFTAALVILLMTAGLGNATQTPEARVPVAVSTGTVKIQSG
FETPINVFGLVESPRATSLSFDMAGQVNTLLVEEGDVVSKGDVLARQDIQRLNARKRELQ
ASLERANADLELARVNSERTTSLVEKKLESAQRLDETKASLNVAKAQVSEMQAALESLNV
EIEKTTLISPFDGVVNRRFFDEGSVVSAGTPVFGITGIENYQARFAVPADVVDQFDLNEP
VLVSVGDIDVAGTVTQRLPVRNVQTRTIDILVTLNSNERVRPGDMAILSGFRSHSETGSW
LPVNALSNGLRGLWRVFVLSNEQNATLEARVVEVVYTDGNNAFVRGALKDGEVYVSEGTH
KLAPGQMVSIPSQHQAGAR