Protein Info for LU632_RS25400 in Erwinia tracheiphila SCR3

Annotation: DotA/TraY family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 77 to 99 (23 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 517 to 540 (24 residues), see Phobius details amino acids 545 to 571 (27 residues), see Phobius details amino acids 600 to 626 (27 residues), see Phobius details amino acids 638 to 662 (25 residues), see Phobius details TIGR04346: conjugal transfer/type IV secretion protein DotA/TraY" amino acids 50 to 675 (626 residues), 412.4 bits, see alignment E=1.9e-127

Best Hits

Predicted SEED Role

"IncI1 plasmid conjugative transfer integral membrane protein TraY" in subsystem Type 4 conjugative transfer system, IncI1 type

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (723 amino acids)

>LU632_RS25400 DotA/TraY family protein (Erwinia tracheiphila SCR3)
MRILFVTETNMKRLLLLLAAFALVGLSLPAFADNINYDTISGAATRSTDLSRQLLIMVYG
DVVNNPLQPQNVSFIGQLYGVFNAIIAGLAFIWFMGVTLRATVLTGNRGKVFGRGNTMMA
PVSSLAGFMALVPTPSGWSISNLAFLWMASIMGVGSANLLTDKAADVIMDGQSMIMQPVA
GETITAARGMFDMYLCKAAMNTEQAEMHQAGSSNTPPMSEQRSSDGREIRISNGSALCGS
AKLPETTDNSALFTFNVPINSAPLESAQMNAFTTISTTLSQSADNFVSAWRSYQDGGQSR
LPDAEAEIQQAARQYEDTITAATASVDNEGTIRSELANYLKQSGWISLGAWYQSFATANQ
KVNSVANQSPIVTGPSNIGETGVGQLQEEIQTALRSQRKNSTFTPPLGSANLPGNDNLDD
VQSANSAIIKVMPKMQVFTAWIANSVMTSGNKDGSTQVNPLLQMKAIGDYTLGTAQATFI
AFTAAKTVVDWGNGTGVGKLVNAVSGAGYIAKSIIGAIAPIVYFVIFILLSIGFSLSIFL
PFIPLIYWITACTSWLASVLIGTTAGSLWAATHIGTEEDKGSRANYGYIFLIDAAIRPSL
MVFGFFFASLVVVAIGTLLNILILPAMANVQADSSTGLASLIGILMIYARTCTTLVSSAF
SLQVYLPDYVIAWLGGREAAQMMKGAVESARSMFAGFGGKAGHAPGLKKVDAAKPGGDAD
GFK