Protein Info for LU632_RS08815 in Erwinia tracheiphila SCR3

Annotation: colanic acid biosynthesis glycosyltransferase WcaL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF20706: GT4-conflict" amino acids 171 to 351 (181 residues), 40.6 bits, see alignment E=3.5e-14 PF00534: Glycos_transf_1" amino acids 222 to 373 (152 residues), 120.6 bits, see alignment E=1.1e-38 PF13692: Glyco_trans_1_4" amino acids 225 to 369 (145 residues), 102.7 bits, see alignment E=4.2e-33

Best Hits

Swiss-Prot: 76% identical to AMSK_ERWAM: Amylovoran biosynthesis glycosyltransferase AmsK (amsK) from Erwinia amylovora

KEGG orthology group: None (inferred from 82% identity to ebi:EbC_29320)

Predicted SEED Role

"Colanic acid biosynthesis glycosyl transferase WcaL" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>LU632_RS08815 colanic acid biosynthesis glycosyltransferase WcaL (Erwinia tracheiphila SCR3)
MKITFFTMRFPVSSETFVLNQVTYFIDQGYDVEIISVFPGDLTHRHGAFDRYNLAEKTHY
LLPEDKSSGMDKLKQRLQILLPKLVNPRTMRSLNVKRYGQQSSKLLLPAIVARNEKSFNA
DLFLVHFGYAGALANKLRELGVLHGKQATVFHGADISRRHILYEHKVDYLNLFSQTDLLL
PISHLWENKLIAMGCPPEKIQVSRMGIEPEKFNFQPREGLHSPLRILSVARLTEKKGLGV
AVEACRYLKAQGASFEYTIIGNGDMEETLRGAIRAADLEDCISMVGFKPQEEIKRYLHQT
DIFLLPSLTAADGDMEGIPVALMEAMAVGLPVVSSEHSGIPELIEHNVSGWLAPEGDARG
LGELLLKLAKSEMDIQPVVAAARKKVETEFNQHIAWRELATLLEQFA