Protein Info for LU632_RS08020 in Erwinia tracheiphila SCR3

Name: nuoM
Annotation: NADH-quinone oxidoreductase subunit M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details amino acids 461 to 479 (19 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 3 to 495 (493 residues), 591.9 bits, see alignment E=4.6e-182 PF00361: Proton_antipo_M" amino acids 133 to 430 (298 residues), 236.5 bits, see alignment E=2e-74

Best Hits

Swiss-Prot: 85% identical to NUOM_ECOLI: NADH-quinone oxidoreductase subunit M (nuoM) from Escherichia coli (strain K12)

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 93% identity to ebi:EbC_30650)

MetaCyc: 85% identical to NADH:quinone oxidoreductase subunit M (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>LU632_RS08020 NADH-quinone oxidoreductase subunit M (Erwinia tracheiphila SCR3)
MLLPWLILIPFIGGLLCWQFERFGSKVPRWIALIAMGLTLALSLQLWLQGGYSLTQAAGG
PKWQSEYLVSWIPRFGINVHLALDGLSLLMVVLTGLLGVMAILCSWNEIEKWQGFFHLNL
LWILGGVIGVFLAIDLFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQA
SGLVMLIAILALVFVNYNATDVWTFNYEDLLKTPMSHTMEYLLMLGFFIAFAVKMPVVPL
HGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFALPLFPHASAEFAPIAMWLGIIGIFY
GAWMAFSQYDIKRLIAYTSISHMGFVLIAIYTGSQLAFQGAVVQMVAHGLSAAALFILCG
QLYERLHTRDMRQMGGLWSRIKWLPALSLFFAVANLGMPGTGNFVGEFMILTGSFQSVPA
IIVTATFGLVFASVYSLVMMQRAYYGVPKSETSLRAMSPREFLIIMVLVVLLVLLGIYPQ
PILDTSHAAMSNIQQWYTASISTTRP