Protein Info for LRK54_RS08030 in Rhodanobacter denitrificans FW104-10B01

Annotation: DNA starvation/stationary phase protection protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF00210: Ferritin" amino acids 37 to 170 (134 residues), 91.2 bits, see alignment E=3.1e-30

Best Hits

KEGG orthology group: K04047, starvation-inducible DNA-binding protein (inferred from 74% identity to axy:AXYL_02901)

Predicted SEED Role

"Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)" in subsystem Oxidative stress (EC 1.16.3.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>LRK54_RS08030 DNA starvation/stationary phase protection protein (Rhodanobacter denitrificans FW104-10B01)
MKKKPVTDRASLLRKQRAPLVTPTDLDARATRDVAGAMNAILADVFALYLKTKNFHWHMS
GPHFRDYHLMLDEQGDQLFAMTDPIAERVRKLGGTTLRSIGHIARLQRVDDNDAEYVEPA
DMLAELREDNLALAARLREAHEVCDKRRDIATASLIENWIDETERRTWFLFETARRSDST
GH