Protein Info for IJEDHG_08470 in Erwinia tracheiphila HP pepo 2.2

Name: ubiA
Annotation: 4-hydroxybenzoate octaprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 91 to 132 (42 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details TIGR01474: 4-hydroxybenzoate polyprenyl transferase" amino acids 11 to 287 (277 residues), 357.9 bits, see alignment E=2.1e-111 PF01040: UbiA" amino acids 28 to 270 (243 residues), 233.8 bits, see alignment E=1e-73

Best Hits

Swiss-Prot: 74% identical to UBIA_SERP5: 4-hydroxybenzoate octaprenyltransferase (ubiA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 86% identity to ebi:EbC_03050)

MetaCyc: 70% identical to 4-hydroxybenzoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
4-hydroxybenzoate nonaprenyltransferase. [EC: 2.5.1.39]

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>IJEDHG_08470 4-hydroxybenzoate octaprenyltransferase (Erwinia tracheiphila HP pepo 2.2)
VEKSLPTSRFQAYSRLMRIDKPIGSLLLLWPTMWALWLAGMQIPPLNILLVFMLGVFFMR
AAGCVVNDFADRKIDGHVKRTQSRPLPSGAVTSTEARTLFVGLVLISFCLVLTMNAMAIW
LSFGGLALAWVYPFMKRYTHFPQVVLGAAFGWAIPMAWAAISESVPLVCWLLFFANICWT
VAYDTLYAMVDRDDDLRIGVKSTAILFGRFDKLIVGLLQFATLVLMLLTGWIMQLGGAFY
WSVMLVGALFIYQQRLIIHRDRDACFHAFLNNNYVGLVLFVGIALSTAPFAAWL