Protein Info for GFF688 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Cardiolipin synthetase (EC 2.7.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF13091: PLDc_2" amino acids 25 to 161 (137 residues), 50.8 bits, see alignment E=1.6e-17 amino acids 213 to 337 (125 residues), 104.1 bits, see alignment E=5.4e-34 PF00614: PLDc" amino acids 110 to 132 (23 residues), 32.3 bits, see alignment (E = 7.3e-12)

Best Hits

Swiss-Prot: 100% identical to CLSB_SALTY: Cardiolipin synthase B (clsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06132, putative cardiolipin synthase [EC: 2.7.8.-] (inferred from 99% identity to ses:SARI_02116)

MetaCyc: 86% identical to cardiolipin synthase B (Escherichia coli K-12 substr. MG1655)
CARDIOLIPSYN-RXN [EC: 2.7.8.41]; RXN0-7272 [EC: 2.7.8.41]

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>GFF688 Cardiolipin synthetase (EC 2.7.8.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKCGWREGNQIQLLENGDQFYPAVFEAIAQAQQKIILETFILFEDEVGKKLHTALLKAAQ
RGVKAEVLLDGYGSPDLSDAFVGELTSAGVIFRYYDPRPRLLGLRTNIFRRMHRKIVVID
DRIAFVGGINYSAEHMSDYGPQAKQDYAVRVEGPVVADILQFEVENLPGQSPARRWWKRH
HQAEENRHPGEAQALFVWRDNEEHRDDIERHYLKMLTQAKREVIIANAYFFPGYRLLHAM
RKAARRGVSVKLIVQGEPDMPIVKVGARLLYNYLVKGGVQVYEYRRRPLHGKVALMDDHW
ATVGSSNLDPLSLSLNLEANLIIHDRTFNQTLRDNLQGIIVNDCKQVDESMLPKRTWWNL
TKSVLAFHFLRHFPALVGWLPAHTPHLAQVPPPAQPEMETQDRVDPENTGVKP