Protein Info for GFF4366 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: putative multidrug transporter membrane ATP-binding components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 27 to 297 (271 residues), 140.9 bits, see alignment E=6.7e-45 PF00005: ABC_tran" amino acids 357 to 505 (149 residues), 108.1 bits, see alignment E=5.6e-35

Best Hits

Swiss-Prot: 88% identical to MDLB_ECOLI: Multidrug resistance-like ATP-binding protein MdlB (mdlB) from Escherichia coli (strain K12)

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to seh:SeHA_C0564)

Predicted SEED Role

"putative multidrug transporter membrane ATP-binding components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (593 amino acids)

>GFF4366 putative multidrug transporter membrane ATP-binding components (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRSFGQLWPTLKRLLAYGSPWRKPLSVAVMMLWIAAAAEVSGPLLISYFIDNMVARHHLP
LGKVAGLAAAYVGLQFLAAGLHYAQSLLFNRAAVGVVQSLRTDVMDAALRQPLSAFDTQP
VGQLISRVTNDTEVIRDLYVTVVATVLRSAALIGAMLVAMFSLDWRMALVAILIFPAVLT
VMIIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQQARFGERMGEASRSHYMA
RMQTLRLDGFLLRPLLSLFSALILCGLLMLFSFTSAGTIEVGVLYAFISYLSRLNEPLIE
LTTQQSMLQQAVVAGERVFELMDRPRQRYGSDDRPLQSGAIDIDHLSFAYRDDNLVLQDI
TLSVPSRSFVALVGHTGSGKSTLASLLMGYYPLTQGEIRLDGREIASLNHRVLRQGVAMV
QQDPVVMADTFLANVTLGRDVSEAQVWQALETVQLADLARGLSDGLHTHLGEQGNTLSVG
QKQLLALARVLVDAPQILILDEATASIDSGTEQAIQQALAAIRERTTLVVIAHRLSTIVE
ADTILVLHRGQAVERGTHQQLLAAQGRYWQMYQLQLVGEELAASVHEEPGPAA