Protein Info for GFF4227 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF00126: HTH_1" amino acids 21 to 79 (59 residues), 63.9 bits, see alignment E=1.1e-21 PF03466: LysR_substrate" amino acids 105 to 308 (204 residues), 114.9 bits, see alignment E=3.5e-37

Best Hits

Swiss-Prot: 45% identical to DMLR_ECOLI: HTH-type transcriptional regulator DmlR (dmlR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to sec:SC0378)

Predicted SEED Role

"Putative LysR family transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF4227 Putative LysR family transcriptional regulator (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKTTPVGKKHRQPLEGWPSVEDLFVFVTVARNGGFARAALELGLSPSYISKRIAILEKCL
NARLFFRNNRVMRLTPEGENALGGAMQVVSEMDGFVSRLDNQRGVLAGNITINCSFGFGH
KYVAEALSSFMIAYPDITVKLTLTDREVDLVEEGIDIEIRVGDDINELYIARQLATNRRI
LCASPEYLERHGKPESVSALVQHDCLMIQEKNSAFGNWILTDGKQQTHCRLNGFHSSNSG
SVVLIWALKGHGITLRSEWDVAQYIERGELVRVLPQWYQEANIWAVYTRRSSSSDRIKIC
IDFLTEHLAQCLPGGKAPGVL