Protein Info for Psest_3692 in Pseudomonas stutzeri RCH2

Annotation: Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF00501: AMP-binding" amino acids 115 to 280 (166 residues), 44.1 bits, see alignment E=2e-15 PF22818: ApeI-like" amino acids 458 to 541 (84 residues), 52.9 bits, see alignment E=6.4e-18

Best Hits

KEGG orthology group: None (inferred from 68% identity to pfo:Pfl01_0436)

Predicted SEED Role

"FIGfam138462: Acyl-CoA synthetase, AMP-(fatty) acid ligase / (3R)-hydroxymyristoyl-[ACP] dehydratase (EC 4.2.1.-)" (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS85 at UniProt or InterPro

Protein Sequence (558 amino acids)

>Psest_3692 Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases (Pseudomonas stutzeri RCH2)
MSWIALCELLTSGESRPVTDAPSLSLAQVQQQALQLAGGLQRRNVRSLAVHLEDAAQLAI
ALLGTWRAGARVLLPADLQPANRERLDAQAELWLTDLPGDHSLTDLLGEPLGAVELDPQL
LGLTLCTSGSSGQPKLIDKRLVQLAHEVETLEALWGADLGAASVIGSVATQHIYGLLFRV
LWPLCAGRPMLRRTLPFAEDMQRASREHPAFCWVASPALLKRMGDNLDWPALRQVRRVFS
SGGPLPIEAAELLQQRLGQWPTEIYGSSETGGIAWRQGGELWQPLPGVELGQDDHGALRV
ASPWLAGGHVEQTADGAKLHADGRFALCGRLDRIVKLEEKRVSLPMLESALAEHAFVSEA
RLGVIQEQRAYLGALVALSEAGIFALRNQGRRAVTQALRQHLNDHCEALALPRRWRLLHQ
LPGNAQGKLPQAELDGLLLAPRPREPERLQQQWQNDHWQIELRVPLDLAHFSGHFPRTPV
LPGVVQIEWAMDLARELFNDLPPRFAGMEVLKFQQLARPGDRLELSLRFDHERGKLYFAY
HNAGKPCSSGRILLGVRP