Protein Info for GFF3483 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Signal peptide peptidase SppA (EC 3.4.21.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 16 to 609 (594 residues), 874.2 bits, see alignment E=4.1e-267 PF01343: Peptidase_S49" amino acids 141 to 294 (154 residues), 142 bits, see alignment E=1.6e-45 amino acids 392 to 543 (152 residues), 173.1 bits, see alignment E=4e-55 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 328 to 541 (214 residues), 175.4 bits, see alignment E=1.2e-55

Best Hits

Swiss-Prot: 100% identical to SPPA_SALTI: Protease 4 (sppA) from Salmonella typhi

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 89% identity to cko:CKO_01793)

MetaCyc: 86% identical to protease IV, a signal peptide peptidase (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Signal peptide peptidase SppA (EC 3.4.21.-)" (EC 3.4.21.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (618 amino acids)

>GFF3483 Signal peptide peptidase SppA (EC 3.4.21.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRTLWRFIAGFFKWTWRVLNFVREMVLNLFFIFLVLVGVGIWMQIGNGSNSEQTARGALL
LDISGVIVDKPSTNHRLGALGRQLFGASSDRLQENSLFDIVNAIRQAKDDRNITGIVLDL
KNFTGADQPSMRYIGKALREFRDSGKPVFAVGENYSQGQYYLASFANKIWLSPQGQVDLH
GFATNGLYYKTLLDKLKVSTHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGELWQNYL
HTVSANRQISPQQLFPGAQAIIDGLTSVGGDTAKYALDHKLVDALASSADVEKALTKQFG
WSKTENNYRAISYYDYSLKTPADTGGTIAVIFANGAIMDGEETPGNVGGDTTASQIRDAR
LDPKVKAIVLRVNSPGGSVNASEVIRAELAAARAAGKPVVVSMGGMAASGGYWISTPANY
IVASPSTLTGSIGIFGVINTVENSLSSIGVHSDGVSTSPLADISMTKALSPEVQQMMQLS
IEYGYKRFITLVADARKRTPEQIDKIAQGHVWTGEDAKANGLVDSLGDFDDAVAKAAELA
KLKQWHLDYYQDEPTVLDMVMDSMTGSVRAMLPETIQAMLPAPLVSAANTVKAEGDKLAA
FNDPQNRYAFCLTCANVR