Protein Info for GFF1778 in Sphingobium sp. HT1-2

Annotation: Gene Transfer Agent capsid protein; Phage major capsid protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR01554: phage major capsid protein, HK97 family" amino acids 21 to 369 (349 residues), 356.4 bits, see alignment E=1e-110 PF05065: Phage_capsid" amino acids 82 to 369 (288 residues), 303.1 bits, see alignment E=1e-94

Best Hits

KEGG orthology group: None (inferred from 86% identity to sjp:SJA_C1-12260)

Predicted SEED Role

"Phage major capsid protein" in subsystem Phage capsid proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>GFF1778 Gene Transfer Agent capsid protein; Phage major capsid protein (Sphingobium sp. HT1-2)
MTEQVTDGLEGAFEAVAQGERIAALEAQLGAMRVQMGRPALDGVKGGEVDPARGAFVERY
LRQGLEAGVELKSFSGASGAAGGYAVPREIDQLIGSTLKAISPIRGIANVVRTGTAGYRK
LVTAGGIVSGWASETGARADTGTPSFNEIAPPSGELYANPAASQAMLDDAQFDVEGWLAG
EIAREFAVAEGAAFVNGNGTNKPKGFLTYTTTSEADSVRAFGSLQYVASGAAGAFAGSNP
QDRLIDLVQSLRAPYRQGASFVMNSATLAAIRKMKTSDGAFIWQPGLAAGQPATLLGYPV
VEAEDMPDIAVNSLSIAFGNFQAGYVIAERSDTSILRDPFSNKPFVHFYAVKRIGGAVAN
SEAIKLMKFAAS