Protein Info for Psest_1604 in Pseudomonas stutzeri RCH2

Annotation: Thiol-disulfide isomerase and thioredoxins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details PF08534: Redoxin" amino acids 132 to 254 (123 residues), 54.4 bits, see alignment E=1.9e-18 PF00578: AhpC-TSA" amino acids 133 to 243 (111 residues), 51.5 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_2707)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLF1 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Psest_1604 Thiol-disulfide isomerase and thioredoxins (Pseudomonas stutzeri RCH2)
MLTVNIGPLALAVPHVILLGSLLLATLTGWWVGRRSERNPERQLFRLLLVALLVARLAFV
ALYWAYYRDDWLSVIDIRDGGFIAWPGLVAALALGIWWGWRDREMRKPLGIALTVGILSW
GFGNLAWHSFEQGTRLPEMALRDNQGRPVALEEYAGQPLVINLWATWCPPCRREMPVLAD
AQARESDTLFLFVNQGEGEGEINRFLEKAGLTLENVLLDSGGRLGQHVGSTALPTTLFYN
ADGRQVSSHLGELSHASLARALEKLKEEAAQ