Protein Info for Psest_1365 in Pseudomonas stutzeri RCH2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 36 to 307 (272 residues), 263.6 bits, see alignment E=6e-82 PF17203: sCache_3_2" amino acids 102 to 211 (110 residues), 39.9 bits, see alignment E=1.1e-13 PF17202: sCache_3_3" amino acids 108 to 213 (106 residues), 100.9 bits, see alignment E=1.2e-32 PF00672: HAMP" amino acids 333 to 378 (46 residues), 53.1 bits, see alignment 8.1e-18 PF00015: MCPsignal" amino acids 455 to 622 (168 residues), 135.1 bits, see alignment E=6.1e-43

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2928)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJF1 at UniProt or InterPro

Protein Sequence (659 amino acids)

>Psest_1365 Methyl-accepting chemotaxis protein (Pseudomonas stutzeri RCH2)
MQQPRAQIATQLGVALALILAVVITGSTLFALRSLNAANLNTREQHLASEARLLADQLAT
FHGTLRENTQRLSGLFEKRFTDGLQLDPEQRIEVGGVMTPALMHEGAPLNNDFSVVDDFR
EMTAGVATVFARDNDDFVRVSTSVTKQDGSRAIGTLLDRQHPAYPLLLSGKQYIGRAFLF
DRHYMTQYTPVKDASGRVTAVLFVGFDYTEAQRAQFDGLARFRIGESGSLALLDEKKQWL
VAPPNLSQPDQAANQVAELGSQSGKGAYWTDGSSDIYSVATLFEGGPWTVLASMPAAEIQ
EVTWSIGSRLAIGNLLAMILAVAATIWLLRHKLKPLAAVVQQAQALGAGDLSVRSQVRSN
DEIGQLAASFNRMGEALSEMVARIRNASGEVSQRAQLLAGLSGGANEGMEQQSGEITSMA
GAVEEFSATSLNIADNMRDTQRVARANAEQTSVGRTAMDEASDALAQIATALSGTARVVG
SLDQRSQEIGSIVGVITAIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTRE
ATDRITGMISQIQAETGNAMSTMELGQRLMDDGLERNAKVAAALALIDEQSRSADEQFSA
ISTATQEQSSTATLLSSNLQSIALANQEQREVVANLAGTASELDRLAAELRTQVDRFRA