Protein Info for Psest_1072 in Pseudomonas stutzeri RCH2

Annotation: TRAP transporter, DctM subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 6 to 52 (47 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 109 to 142 (34 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 192 to 217 (26 residues), see Phobius details amino acids 237 to 262 (26 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 333 to 375 (43 residues), see Phobius details amino acids 382 to 407 (26 residues), see Phobius details amino acids 419 to 443 (25 residues), see Phobius details PF06808: DctM" amino acids 12 to 442 (431 residues), 248.8 bits, see alignment E=4.9e-78 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 449 (428 residues), 284.6 bits, see alignment E=5.8e-89

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_3224)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFX7 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Psest_1072 TRAP transporter, DctM subunit (Pseudomonas stutzeri RCH2)
MGLEEILVIAMFASFMGLLLLGFPVAWSLAGIGLLFAVLGYVLVEHFDANLWFTWDGTIG
VLDARIYGIVANELMVALPLFIFMGIMLDRSGIAERLMHSLVRVLGPLRGGYAVTVVVVG
ILLAASTGIVGASVALLGMLSIGPMLQANYNKSLAVGTACSVGTLGILIPPSIMLVLMAD
RLGTSEASVGKLFMGALIPGMMLALMYILYIVIVAWLKKDFAPAPVNRPKLDARALLDVF
WAVVPPLALIFAVLGSIFFGIATTTEASAVGAFGALLMAAASRRLNLPVLKDALYQTSRT
AAFIFGIFIGATVFAAVLRGLGGDDVIRAALTGLPFGQTGVLLTVLAITFLLGFFLDWVE
ITLIILPLVAPVLFSMGVDPLWFAILFALCLQTSFLTPPVGFALFYIKGVCPPGITTRDV
YLGVLPYIVIQLIGLALVFYFAPLATWLPNEVYSQP