Protein Info for EX28DRAFT_3412 in Enterobacter asburiae PDN3

Annotation: Inorganic pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF00719: Pyrophosphatase" amino acids 18 to 172 (155 residues), 199.1 bits, see alignment E=1.9e-63

Best Hits

Swiss-Prot: 98% identical to IPYR_SALTY: Inorganic pyrophosphatase (ppa) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 96% identity to esa:ESA_00231)

MetaCyc: 94% identical to inorganic pyrophosphatase (Escherichia coli K-12 substr. MG1655)
Triphosphatase. [EC: 3.6.1.25]; Inorganic diphosphatase. [EC: 3.6.1.25, 3.6.1.1]

Predicted SEED Role

"Inorganic pyrophosphatase (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.1 or 3.6.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>EX28DRAFT_3412 Inorganic pyrophosphatase (Enterobacter asburiae PDN3)
MSLLNVPAGKELPEDIYVVIEIPANADPIKYEVDKESGALFVDRFMSTAMFYPCNYGYIN
HTLSLDGDPVDVLVPTPYPLEPGSVIRCRPVGVLKMTDESGEDAKLVAVPHTKLSKEYDH
IKDVNDLPELLKAQITHFFEHYKDLEKGKWVKVDGWDNAEAAKAEIIASFERAAKK