Protein Info for EX28DRAFT_2623 in Enterobacter asburiae PDN3

Annotation: Enolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF03952: Enolase_N" amino acids 6 to 132 (127 residues), 52.4 bits, see alignment E=6.3e-18 PF00113: Enolase_C" amino acids 140 to 420 (281 residues), 208.6 bits, see alignment E=1.3e-65

Best Hits

Swiss-Prot: 32% identical to ENO_HALHL: Enolase (eno) from Halorhodospira halophila (strain DSM 244 / SL1)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 32% identity to hha:Hhal_1437)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.11

Use Curated BLAST to search for 4.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>EX28DRAFT_2623 Enolase (Enterobacter asburiae PDN3)
MVKTAITALIARKVWSSSGLPALEIEVFIDKRISARAIAQSGLSGGYVDPILNSENICTN
LHKMLDSKIQYIDKILTPQLLGQRIDDQLIIDSILSLSTQNNKLSHADTAAISIAVADLA
ARYYAIPLWKYIQQEYIEPVMPLPEIEIFGGGAHASYASTVQDVMVIAPGAENYQHALCI
GAEIFQRIKNQLVKAGKPTGLCEKGGLWPSYDHFRHALEMVSEAIAHSGLTAGKDIGIAI
DFAADGFYETGHYWLNGNEGSGQTSDDYIATLTSLIKEFPIMSLEDPLAVEDRAGYRKLM
QLSGKQVQIISDDLLDSDPRLVQSEDAALLCNAIMIKPAKSGTLTKTISALSHARSKGWG
AIMAGRSIDSEDTAVMHLAVGLGVGQFKIGSLARAERSAKFNEGIRIAEASRDLVFAGAK
ELP