Protein Info for EX28DRAFT_2356 in Enterobacter asburiae PDN3

Annotation: Uncharacterized conserved protein, contains double-stranded beta-helix domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF03079: ARD" amino acids 4 to 165 (162 residues), 126.3 bits, see alignment E=6.6e-41

Best Hits

Swiss-Prot: 96% identical to MTND_CITK8: Acireductone dioxygenase (mtnD) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K08967, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC: 1.13.11.53 1.13.11.54] (inferred from 97% identity to enc:ECL_03088)

MetaCyc: 88% identical to acireductone dioxygenase (Klebsiella oxytoca)
Acireductone dioxygenase (Fe(2+)-requiring). [EC: 1.13.11.54]; Acireductone dioxygenase (Ni(2+)-requiring). [EC: 1.13.11.54, 1.13.11.53]

Predicted SEED Role

"1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54)" in subsystem Methionine Salvage (EC 1.13.11.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.53 or 1.13.11.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>EX28DRAFT_2356 Uncharacterized conserved protein, contains double-stranded beta-helix domain (Enterobacter asburiae PDN3)
MSALTIYSDKDASQHQWHSTDAAEIAQQLNAKGVRFERWAADRDLGHDPAPEAVIAAYQH
AIDKLVAEKGYQSWDVISLRADNPQKEALRAKFLNEHTHGEDEVRFFVEGAGLFCLHIGD
EVYQVLCEKNDLISVPAGTPHWFDMGSEPNFTAIRIFDNPEGWVAQFTGDAIADAYPRLA