Protein Info for EX28DRAFT_1194 in Enterobacter asburiae PDN3

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 66 to 79 (14 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 221 to 262 (42 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 302 to 463 (162 residues), 134.3 bits, see alignment E=1.7e-43 PF00990: GGDEF" amino acids 302 to 461 (160 residues), 134.3 bits, see alignment E=1.7e-43

Best Hits

KEGG orthology group: None (inferred from 86% identity to enc:ECL_01988)

Predicted SEED Role

"FIG00626141: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>EX28DRAFT_1194 diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MRSALTAFRPFQVDTPLRNAATIFILTTLFYFVGAELRLVEALSLFWPLNGVMAGIFARY
VYLNRLHYYAVCYVAMLLYDAVTTNWGMASVVINLSNMIFIVAVAVLVQRDKRLMKKTPD
PLNALRLFNYCLIAALLCALLGAVGSVGIDSHTFWPLFADWFSEQFSTGVLVVPCMLTLR
MPGRELRLRLEQLLPVIALIVSVIASVVIGGAGSLSFPLPALIWCAVRYSLPATCLLTFI
TGATEIILVANSVINIAVATPFTTPMMFSARLGIATMAICPVMVSVSMAAINSLIRQVSL
RADYDFLTHVYSRSGLYEALKHEETYRHTRFLTVMLLDIDYFKSINDNYGHECGDRVLAS
FARQVQQVVGEDGMVARMGGEEFAVVVNSGDAQHGFELAERIRSTVASHPFTWRHQTLYL
TVSIGLGSGKAEPWQLTEVFNKLMAEADDHLYRSKKAGRNRTSARVADEQLAAPSGSET