Protein Info for CA265_RS21110 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 27 to 44 (18 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details PF01148: CTP_transf_1" amino acids 2 to 266 (265 residues), 200.4 bits, see alignment E=2.6e-63

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 76% identity to phe:Phep_0020)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZA23 at UniProt or InterPro

Protein Sequence (269 amino acids)

>CA265_RS21110 phosphatidate cytidylyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MKTRAITAFFFTIVMLGSILLGSYTFTIFYLVLSVLALFEFYKLIKNAGIRPHRNIGLAA
SSLIFLMAAGLHYLKYDVKYLLLCIPLIFSVFITELYKKNKIPFANISYTFVGFVYVTIP
FCFFHALGFLKNWSEYNFHLPLAFLLMLWANDTGAYLFGVKYGKRKLFERHSPKKSWEGF
FGGMFTSVLVAFGLSFLFTESPAWVWIGMAVLIACFGTLGDLVESMLKRSLDTKDSGGLL
PGHGGLLDRFDGLLLAAPVVYAYLYLILY