Protein Info for BWI76_RS23535 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF13412: HTH_24" amino acids 1 to 48 (48 residues), 76 bits, see alignment E=2.7e-25 PF13404: HTH_AsnC-type" amino acids 1 to 42 (42 residues), 64.3 bits, see alignment E=1.4e-21 PF09339: HTH_IclR" amino acids 14 to 47 (34 residues), 28.1 bits, see alignment 2.8e-10 PF01037: AsnC_trans_reg" amino acids 75 to 141 (67 residues), 68.5 bits, see alignment E=7.5e-23

Best Hits

Swiss-Prot: 40% identical to PUTR_RHOCA: Proline dehydrogenase transcriptional activator (putR) from Rhodobacter capsulatus

KEGG orthology group: None (inferred from 97% identity to eae:EAE_02380)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7W9 at UniProt or InterPro

Protein Sequence (153 amino acids)

>BWI76_RS23535 hypothetical protein (Klebsiella michiganensis M5al)
MDSIDRKILAELQADGRLSITELAERVNLSLSPCHRRLRTLEQEGVITGYRANLDPAKMG
FNFLAIVFATLKEGDKKAVSAFEDAVEEIPQIVLAQRLFGDPDYLMHVVTRDLPAFQKLY
DDKLSAMPGVQHLRSTLVMKTVVQDRPFPLGKG