Protein Info for BWI76_RS22905 in Klebsiella michiganensis M5al

Annotation: ATPase AAA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 572 to 589 (18 residues), see Phobius details PF00158: Sigma54_activat" amino acids 17 to 175 (159 residues), 229.6 bits, see alignment E=5.5e-72 PF14532: Sigma54_activ_2" amino acids 17 to 182 (166 residues), 70.3 bits, see alignment E=6.1e-23 PF07728: AAA_5" amino acids 35 to 152 (118 residues), 35.4 bits, see alignment E=3e-12 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 352 to 631 (280 residues), 186.8 bits, see alignment E=2.7e-59 PF09084: NMT1" amino acids 374 to 569 (196 residues), 32.3 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: None (inferred from 69% identity to pva:Pvag_pPag10059)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AXV1 at UniProt or InterPro

Protein Sequence (647 amino acids)

>BWI76_RS22905 ATPase AAA (Klebsiella michiganensis M5al)
MLNPEFPSSTPTLIDPASKAFQSLLDKLAPTEATVLIVGETGTGKEVVARYLHHHSPRRQ
RPFLAVNCGALSESLAEAELFGHEKGAFTGAVQSHPGWFEAAEGGTLLLDEIGELSLALQ
VKLLRVLQEREITRVGSRKAVKVDVRVIAATHVDLMQAIRERRFREDLYYRLNIAIVPLP
PLRQRRQDIPVLADHFLSLYARRLGRPIRRLAPETLARLMEYPWPGNIRELENTLHNAVL
LSKEEEIGPAQLRLTTLNNEPSAVGDNELDDFIRRQLSLPGEPLWERVTGALIRGAMAHS
DDNQSQAAALLGISRHALRTQLANLGIIKSRRRQEPLYSAAVKKVSRDRELRIGFQRFGN
LGILKARQSLEQAFASRGVSVLWSEFPAGPQLLHALACDEIDFGTTGEAPPVFAQATNSE
LVYVAWEPPAPQSVAMVVPQHSDIRTLSDLRGKRIALNKGSNVHWLLLHILEEAGLALND
VKVVYIPPKYPLTASDYLAVDAWMMWDPLLSDAEYSGELRVVASGEGRVNNHQFYLSRRD
YASRNSDIMQRLLAELTQTGQFIDQHRQEAVGLLSAELGLNAASLARALARRSHRPRPMD
LNVIRAQQSIADRFYALGLIHKPVSVREAVWYGEATHSDPRPLMHVG