Protein Info for BWI76_RS16085 in Klebsiella michiganensis M5al

Annotation: two-component system sensor histidine kinase DcuS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details PF17203: sCache_3_2" amino acids 56 to 181 (126 residues), 70.9 bits, see alignment E=3e-23 PF00989: PAS" amino acids 226 to 258 (33 residues), 24 bits, see alignment (E = 8.5e-09) PF14689: SPOB_a" amino acids 336 to 370 (35 residues), 34.1 bits, see alignment 4.1e-12 PF02518: HATPase_c" amino acids 430 to 532 (103 residues), 69.8 bits, see alignment E=6.5e-23

Best Hits

KEGG orthology group: None (inferred from 84% identity to eae:EAE_18235)

Predicted SEED Role

"Fumarate respiration sensor kinase protein DcuS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4S6 at UniProt or InterPro

Protein Sequence (539 amino acids)

>BWI76_RS16085 two-component system sensor histidine kinase DcuS (Klebsiella michiganensis M5al)
MNEFAQPASPARKRAMSMKLSTAVTLMIGSVIGSVLILVYALWFMQISGATRDGVKDTAL
AVARTLADAPEVKRGLTLPPESGIIQPLALAVARRNGLLFAVVTNMDGIRYSHPNSQIIG
KPFIGEDIRPTLAGKENVAVNHGVLAPALRVFTPVFDDSRRQIGVVAIGISLSKVDTQIA
ASRWDVILTVLFSAVVCAVGTWSLVRGLKRVLLGLEPQEISTQFQQRQAMLHSLKEGVVA
VDADGQVTLINPAARDILFSGPDSDIAQTPLLADLQEVLQTGEPIYDRELGCNGLLLISN
TVPVRDEDDVVGAISTFRDKTEVSQLLQRLDGMVNYVDALRTTSHEFMNKLHVILGLLNM
KSYDKLEEYVLQTAHTYQADIGEIQHRIKSPVVAGFLIGKIQRAKERGFTLTLAEESLVP
DCPNEKQITVLVTVLGNLIENALDAMSGQAEGEVSLLLHYQNGWLSGEVSDDGPGIPEAF
IDDIFNKGFSTKGENRGVGLFLASQQLRELGGSLAVESEPGVFTQFFVHLPWDSKRKSA