Protein Info for BWI76_RS14920 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 179 to 194 (16 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 242 to 269 (28 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details PF01032: FecCD" amino acids 18 to 332 (315 residues), 275.3 bits, see alignment E=3e-86

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 83% identity to kpu:pK2044_00020)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B480 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BWI76_RS14920 ABC transporter permease (Klebsiella michiganensis M5al)
MRGTQFRYCWAMWGALPLLAGLMLLSVAKGSVPLSLAQVLGALRLLDVPVSEMIGRIVID
LRVPRTLLSVLAGAVLAIVGGLLQTTTRNDLADPFLFGLSSGASAGAVLVITRFGERLGA
LTLPVSAFVGGLCSAVAVMLLFHFKKQRGAEHLVICGLAISFLFGALTSYLIFSGDQRAA
SSVLFWSLGGLGLARWDNLPYAVFSLLFLGAFVLLRWRSLDGLLAGEQTAQSLGINVGRL
RIEVFFCCALATSLLVALTGVIGFIGLMVPHMCRYFSGVKHLLLLPLCGLWGAVLLCGGD
IVSRTLLAPQELPIGIITAGIGGLFIIILLARNRA