Protein Info for ABZR87_RS09920 in Ralstonia sp. UNC404CL21Col

Annotation: electron transport complex subunit RsxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 9 to 160 (152 residues), 230.2 bits, see alignment E=7.4e-73 PF04060: FeS" amino acids 20 to 52 (33 residues), 50.4 bits, see alignment 5.9e-17 PF12837: Fer4_6" amino acids 86 to 109 (24 residues), 27.3 bits, see alignment (E = 9.9e-10) PF14697: Fer4_21" amino acids 87 to 141 (55 residues), 69 bits, see alignment E=1.3e-22 PF13237: Fer4_10" amino acids 88 to 135 (48 residues), 28.9 bits, see alignment 3.5e-10 PF00037: Fer4" amino acids 88 to 109 (22 residues), 34.6 bits, see alignment (E = 4.7e-12) amino acids 119 to 139 (21 residues), 21.5 bits, see alignment (E = 6.5e-08) PF12797: Fer4_2" amino acids 88 to 106 (19 residues), 25.7 bits, see alignment (E = 3e-09)

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 96% identity to rpf:Rpic12D_0937)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>ABZR87_RS09920 electron transport complex subunit RsxB (Ralstonia sp. UNC404CL21Col)
MVSLVPAVAATLADRLENLLPQTQCTKCGYNGCRPYAEAMASGEALPNRCPPGGAEGIRR
LSDALGRTGDLLPLDPSNGIEQPRAIAVIDPERCIGCTLCIQACPVDAIVGAPKAMHTVL
EDWCTGCDLCVPPCPVDCIDMRPVTGDRTGWDAWSQQQADVARDRYVFRNARLKREQAEN
EARLAAKAAAKLAAVSAEQPADDAELAAQARKKAIIQAAIERARQKQAEMAARGLGPRNV
TNVSADVQAQIDEAEARRKRIASQIERSAKPDADKP