Protein Info for ABZR87_RS02610 in Ralstonia sp. UNC404CL21Col

Annotation: type 4a pilus biogenesis protein PilO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details PF04350: PilO" amino acids 62 to 199 (138 residues), 138.9 bits, see alignment E=7e-45

Best Hits

KEGG orthology group: K02664, type IV pilus assembly protein PilO (inferred from 98% identity to rpf:Rpic12D_2904)

Predicted SEED Role

"Type IV pilus biogenesis protein PilO" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>ABZR87_RS02610 type 4a pilus biogenesis protein PilO (Ralstonia sp. UNC404CL21Col)
MALSTEISLEDLVSQFRGLNLNEPETWPIAPRILFMILSAVLVIGLGWQFYWSGKFDERD
AKRTEQDNLKAAYQSKLAQVVNLEALRKQKAEVEQRVAKLELQLPNKTEMDALLADVNHA
GIARGLTFDLFRPSGAVIKPYYAEIPVAVKVNGRYHDMALFAADVAALSRIVTLQNISLT
GTKDGGMVMETRAEAYRALDADEQAAQRKANAAAKGGAK