Protein Info for Sama_0374 in Shewanella amazonensis SB2B

Name: pdhR
Annotation: transcriptional regulator PdhR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00392: GntR" amino acids 13 to 74 (62 residues), 85.8 bits, see alignment E=1.3e-28 PF07729: FCD" amino acids 99 to 223 (125 residues), 58.3 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 57% identical to PDHR_ECOL6: Pyruvate dehydrogenase complex repressor (pdhR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 100% identity to saz:Sama_0374)

Predicted SEED Role

"Transcriptional repressor for pyruvate dehydrogenase complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2H9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Sama_0374 transcriptional regulator PdhR (RefSeq) (Shewanella amazonensis SB2B)
MAYSKINQPKISDVIMQQLERMILEGSLKPGQKLPPERELAIQFEVSRPSLREAIQKLEA
KGLLMRRQGGGTYVKEQLWQSMADPIVELMQSDTESQYDLLEFRHATEGMMAYFAALRGT
DADMNNIQKMILEVEEAQTIESKADAIVRFYRAVAEASHNVAMLHLVLSLTPVLHKNVAQ
NLELLSRREDASRMANEHRRALLAAIVRRDPEAAREASNEHLSYIEEVMLAVREEDSRLQ
RSLRRLKSGA