Protein Info for Shew_3051 in Shewanella loihica PV-4

Annotation: cupin 2 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00190: Cupin_1" amino acids 66 to 147 (82 residues), 23.4 bits, see alignment E=5.7e-09 PF07883: Cupin_2" amino acids 71 to 136 (66 residues), 48.5 bits, see alignment E=8.5e-17 PF02311: AraC_binding" amino acids 76 to 125 (50 residues), 21.8 bits, see alignment E=2.1e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3051)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHG9 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Shew_3051 cupin 2 domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MKSIISAFVISSSLLGLSGQVVGETLPPPSISVASNGTQLPMQGLEPYFIGKTRVEPLFG
AKGEGRTSGAMVTFEPGSRTNWHTHPIGQTLIVTSGLGWVQQWDGKRIEIAPGDVVQIPA
NVKHWHGATDKTAMSHIAVQEAKEGSVVNWLEPVSAAQYQGH