Protein Info for Shew_2524 in Shewanella loihica PV-4

Annotation: decaheme cytochrome c (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF22112: OmcA-like_N" amino acids 54 to 216 (163 residues), 275.3 bits, see alignment E=2.6e-86 TIGR03507: decaheme c-type cytochrome, OmcA/MtrC family" amino acids 60 to 721 (662 residues), 401.5 bits, see alignment E=3.7e-124 PF22113: Mtrc-MtrF_II-IV_dom" amino acids 222 to 337 (116 residues), 68.7 bits, see alignment E=7.3e-23 amino acids 553 to 723 (171 residues), 100.8 bits, see alignment E=1e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2524)

Predicted SEED Role

"surface localized decaheme cytochrome c lipoprotein, OmcA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFZ2 at UniProt or InterPro

Protein Sequence (725 amino acids)

>Shew_2524 decaheme cytochrome c (RefSeq) (Shewanella loihica PV-4)
MMKKFNVNAATKAVLGAGLLSFALSGCGSDGKDGEDGKDGVIGVNIDTTPTLQATFTNAT
IDAGKVTVDFKLQDANGVAVLGLTKDHDLRFGVAQLTHVVETKADGETADRGFQWQAYIN
SEKAPNPDWVPEGDTDINPSNQFQANVEQAAKCDDCLVDNEDGSYTYTFQTNIANVTSPV
TVTYDADATQRITLELEQPSVTANANYDFQPSSGATKGIQTRNVVAIETCYTCHQPESLA
LHGGRRINIENCASCHTATSGDPETGNSVDFTYMIHAIHRGEERHTYDADGNQVPAPYKV
IGYGGGVHDYGKVMFPQKPAADCSACHVEGSNAPANADLYKADLSNTACIACHSEKPSSH
HSSTDCMACHNSTEPYGGTGSAFKRHGDVLKAYQDAEAMSVKFSNIGVDANGKFVFDVQV
LGADGAALDGELLDPKSRVVVAWDIDKDFPAYSDASYSNRRIALEEGVYNAETKTYTLTG
TKFDLPADANGKTFELWSALKVCFNNGGYGVAEIKPTACATEGVRKVEAKQEAMHFVWKD
GAIDDSATPAERRDIIDPSKCQGCHNQENHHYNNGYNCQTCHTSDKTTKANASEQYPNAK
KPTSYAYKAHEAEGHFLKYAGVGSSTVVKTDCMTCHTDGGIELGRAPERTWRYGNLLTGE
DIWVSSDAGACMSCHQKYLSDAAKSHIETNGGILDGVDADDVRTRAAETCKTCHTPEKVM
ELHGH