Protein Info for Shew_2517 in Shewanella loihica PV-4

Annotation: ferrous iron transport protein B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 transmembrane" amino acids 278 to 302 (25 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 425 to 447 (23 residues), see Phobius details amino acids 454 to 473 (20 residues), see Phobius details amino acids 511 to 532 (22 residues), see Phobius details amino acids 667 to 688 (22 residues), see Phobius details amino acids 695 to 716 (22 residues), see Phobius details amino acids 727 to 745 (19 residues), see Phobius details TIGR00231: small GTP-binding protein domain" amino acids 3 to 152 (150 residues), 45.8 bits, see alignment E=5.8e-16 PF02421: FeoB_N" amino acids 6 to 165 (160 residues), 201.1 bits, see alignment E=2.2e-63 PF01926: MMR_HSR1" amino acids 7 to 124 (118 residues), 78.6 bits, see alignment E=1.2e-25 TIGR00437: ferrous iron transport protein B" amino acids 11 to 690 (680 residues), 594.6 bits, see alignment E=2.4e-182 PF07670: Gate" amino acids 352 to 445 (94 residues), 84.4 bits, see alignment E=2.2e-27 amino acids 513 to 693 (181 residues), 60.6 bits, see alignment E=5.6e-20 PF07664: FeoB_C" amino acids 455 to 506 (52 residues), 56.6 bits, see alignment 5e-19

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 100% identity to slo:Shew_2517)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFY5 at UniProt or InterPro

Protein Sequence (764 amino acids)

>Shew_2517 ferrous iron transport protein B (RefSeq) (Shewanella loihica PV-4)
MAKQFHCVTVGNPNAGKSTLFNALTGANQQVGNWSGVTVEKKTGAFTLNDTQVLLTDLPG
IYDLLPAGSSCDCSLDEQIAQQYLAEAQMDGIINLVDATNIERHLYLTVQLRELGIPMVV
VINKIDAAKAHGIEVDVDKMSQQLGCPVIAVCSRDMNDIKQVQAQVVDLLDGKVSEAPLV
LDYDVEIEAGIKALFERDSQLSRGRALAMMGNGLGCGQCKNGQMLSEVSQCSERLAAQGK
DIEIMVATTRFDFVQQVFNKSVKDSDQLTLSDRLDKLVLHPIAGVPVFLFVMYLMFMFSI
NVGSAFIDFFDITAGALFVDHLGALMTNIGAPAWLVTIVAGGMGQGIQTVATFIPVIAAL
FLALSVLEGSGYMARAAFVVDGLMRRIGLPGKAFVPMIVGFGCSVPAIMATRTLGSERER
IVTGMMAPFMSCGARLPVYALFAAAFFPESGQNLVFLLYIIGVLAAVGTGLLLRSTLLPG
SSSAVVMELPNYEKPKLKAVMARTGKRTKSFILGAGKTIVIVVTLLNFINAIGVDGSFGH
EDSSESVLSVASQKVTPLFSPMGIEQDNWPATVGIITGIFAKEAVVGTLNSLYSTASGED
EALAPLSESFSEALATIPENLFGIAPEDPLSISVGDIQTIETASSELDVDTSTFSALQSG
FSGVTAAFAYLLFILLYTPCVAAMGALVGEFGPRWATFAATWTLGLAYGTATVFYQAMTF
AAHPLQSGLWIAFFLVALVVFYLWLKRKGQRAQTIIPVINVVTE