Protein Info for Shew_1026 in Shewanella loihica PV-4

Annotation: cobalamin biosynthesis protein CbiB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 67 to 93 (27 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details PF03186: CobD_Cbib" amino acids 21 to 299 (279 residues), 114.4 bits, see alignment E=3.1e-37

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to slo:Shew_1026)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBP9 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Shew_1026 cobalamin biosynthesis protein CbiB (RefSeq) (Shewanella loihica PV-4)
MHDLIQQLLLDSPFYQGASILLVAIFMALLAPLPREYQAFYWFSQLARSLSAKVARADRS
ANQQRVAGSLSVLLLVLPFWLILSFLLELAAFPWFFECLFLYLCLCDEQFHKVAEETGQA
LARQDKQRARRLLSQWVYRDTRELSEVGMSKTVIEKLMTTSIYGTVATILFFAVGGAPLV
LGARMVKQLEYTWPALNPQYREFGRPVYLLSSLLYWLPTQAWNFTLAIQGGPGAVVQLLR
PTKSPLPINNHLATCALAAKVLNTELGGPQKFAGQRVDIARIGTGPKPTPHTITAALRLL
RLSKGIWVLSVLLIPCLWATLRLLAHA