Protein Info for Shew_0198 in Shewanella loihica PV-4

Annotation: competence/damage-inducible protein CinA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR00177: molybdenum cofactor synthesis domain" amino acids 1 to 161 (161 residues), 91.8 bits, see alignment E=6e-30 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 1 to 410 (410 residues), 367.2 bits, see alignment E=1.4e-113 PF00994: MoCF_biosynth" amino acids 5 to 169 (165 residues), 105.9 bits, see alignment E=1.5e-34 PF02464: CinA" amino acids 254 to 406 (153 residues), 178.3 bits, see alignment E=8.6e-57 TIGR00199: amidohydrolase, PncC family" amino acids 263 to 407 (145 residues), 142.4 bits, see alignment E=1.7e-45

Best Hits

Swiss-Prot: 100% identical to CINAL_SHELP: CinA-like protein (Shew_0198) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 100% identity to slo:Shew_0198)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3Q9C2 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Shew_0198 competence/damage-inducible protein CinA (RefSeq) (Shewanella loihica PV-4)
MKIEMICTGEEVLSGQIVDTNAAWAANALMDHGIEMQQRITVGDRLDDLVEVFRQRSEHA
DVILVNGGLGPTSDDMSSEAMAIAKGEPLVECTLWRERIQEWFTRNGRHMPESNLKQAML
PASAIMVDNPVGTACGFRVKLNRAWLFFTPGVPFEFKKMVTEQFIPFVEQIADSHIEVEV
QKLLTIGQGESALADKLEGMPLPDGMTLGYRSFMPYIEIKLFARGEAAIGELDRVKAEVL
TRLGDAVVGHNVASLAQVIHNGLLASGKRLSIAESCTGGMIANNLVAFAGSSNYLDQGLV
TYSNESKVRVLGVKPATLDDHGAVSIATVEEMAKGARGLLDSDYALATSGIAGPDGGSEA
KPVGTVAIALATRQGVYSQMLKFPARSRELVRQLSTAVALDMLRRELQESPVLVDYSSYP
RFAR