Protein Info for DVU1632 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: PTS system, IIA component (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF03610: EIIA-man" amino acids 12 to 114 (103 residues), 75.5 bits, see alignment E=1.9e-25

Best Hits

KEGG orthology group: K02793, PTS system, mannose-specific IIA component [EC: 2.7.1.69] (inferred from 100% identity to dvu:DVU1632)

Predicted SEED Role

"PTS system, mannose-specific IIA component"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BK3 at UniProt or InterPro

Protein Sequence (145 amino acids)

>DVU1632 PTS system, IIA component (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTEKDNVEARVGVIIVTHADYGSALLRAAEFILGAQSDCTSISIDVSQEVGETVTRLKEA
VGRLDKGNGAIILTDMFGGTPTNLSLSLLATSNVEVVTGVNLPMLLKVFGSRTMPLAQLA
AEAGEAGGKGIIVAGQMLRSKTRNG