Protein Info for SO1274 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 67% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 100% identity to son:SO_1274)

MetaCyc: 67% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)"

MetaCyc Pathways

superpathway of ornithine degradation (6/8 steps found)
putrescine degradation II (3/4 steps found)
superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EHE9 at UniProt or InterPro

Protein Sequence (428 amino acids)

>SO1274 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSAIPHTGSYYAASANDKVERARLQESIEADVCVIGAGYTGLSAALHLLELGFSVVVLDA
ARIGWGASGRNGGQIVNSYSRDIDTIEKTVGKEQAKLFGKMAFEGGRIIRERIAKYNISC
DLKDGGVFAAMNEKQMGHLRHQKQLWESHGHMGQLELLDGKGIRSVVNTERYVGGMLDKS
GGHIHPLNLALGEARAVESLGGKIFEDSAVLRVDEGDNPVVHTATGSVKAKFVVVAGNAY
LGKLMPELQAKSMPCGTQVITTEPLDEDLAASLLPQDYCVEDCNYLLDYFRLSGDKRMIY
GGGVVYGARDPADIESLIIPNMLKTFPQLKGVKVDYAWTGNFLLTLSRLPQVGRIGKNIY
YSQGCSGHGVTYTHLAGKLIAEMLNGQATRFDAFAALPHYPFPGGHALRVPFSALGAWYY
SLRDKLGV