Protein Info for Xcc-8004.3118.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF02464: CinA" amino acids 8 to 161 (154 residues), 186.5 bits, see alignment E=1.2e-59 TIGR00199: amidohydrolase, PncC family" amino acids 14 to 158 (145 residues), 163.5 bits, see alignment E=1.9e-52

Best Hits

Swiss-Prot: 57% identical to PNCC_ECOL6: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03743, (no description) (inferred from 100% identity to xcb:XC_2513)

MetaCyc: 57% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XA60 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Xcc-8004.3118.1 C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS (Xanthomonas campestris pv. campestris strain 8004)
MSTDSELQQLSEVLGQQLLAARERLVTAESCTGGWIAKAVTDVAGSSHWFECGMAAYSYE
AKQALLGVRPQTLEVHGAVSRETVIEMVSGALVNSGASIAVAVTGIAGPGGGSDDKPVGT
VWIGWKRRGGYATAQLFHFSGDRDAVRRQTVAAALRGLSALL