Protein Info for Xcc-8004.1395.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details TIGR00380: cobalamin biosynthesis protein CobD" amino acids 5 to 295 (291 residues), 197.7 bits, see alignment E=1.3e-62 PF03186: CobD_Cbib" amino acids 7 to 283 (277 residues), 316.8 bits, see alignment E=6.3e-99

Best Hits

Swiss-Prot: 61% identical to COBD_PSEU5: Cobalamin biosynthesis protein CobD (cobD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to xcb:XC_1096)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X4N3 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Xcc-8004.1395.1 Adenosylcobinamide-phosphate synthase (EC 6.3.1.10) (Xanthomonas campestris pv. campestris strain 8004)
MLLLIATAAVLLDLLLGEPARAHPLVLFGGWAQRIEARLHRDMRAAGVLAWCVAVLPWAA
VAALVQLALWWWSAWAGAAFAAVALYLALGLRSLGEHAVPVAQALRAGDLPAARAAVGRI
VSRDTATLDEAQVAAAATESVLENGSDAVFAALFWGVLLGAPGAVLYRLSNTLDAMWGYR
TPRYQRFGWAAARMDDALNWLPARMTALTYAVLGQTRAGVRCAWRQGRGWKSPNAGPVMA
AGAGALQVQLGGPAPYHGQWQHRPSLGEGAAADAGSVLRALWLVRAGVALWLLLAGLATA
VLR