Protein Info for SGL_RS15530 in Synechocystis sp000284455 PCC 6803

Annotation: phosphoribosylformylglycinamidine synthase subunit PurQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 4 to 223 (220 residues), 315.1 bits, E=1.1e-98
• PF13507: GATase_5
  • amino acids 6 to 213 (208 residues), 144.3 bits, E=3.9e-46
• PF07685: GATase_3
  • amino acids 31 to 95 (65 residues), 31.3 bits, E=1.6e-11

Best Hits

Swiss-Prot: 100% identical to PURQ_SYNY3: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 100% identity to syn:slr0520)

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Protein Sequence (224 amino acids)

>SGL_RS15530 phosphoribosylformylglycinamidine synthase subunit PurQ (Synechocystis sp000284455 PCC 6803)
MTSFGIIVFPGSNCDRDIATVTAGLLDQPTRFIWHQETDLHGVDVVVLPGGFSYGDYLRC
GAIARFSPIMTAIIDHANAGKRVLGICNGFQVLTEVGLLPGALIRNRDLHFICDRVTVRV
ESNQTVWTKGYQSQQVITLPIAHGEGRYFADGDTLKALEDNEQILFRYSNAQGELTTDSN
PNGSLHNIAGITNVQGNVLGMMPHPERAADRLLKATDGLAMFIS