Protein Info for SGL_RS10910 in Synechocystis sp000284455 PCC 6803

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 330 to 360 (31 residues), see Phobius details amino acids 372 to 398 (27 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details PF06808: DctM" amino acids 12 to 435 (424 residues), 297.9 bits, see alignment E=5.9e-93 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 440 (419 residues), 448.4 bits, see alignment E=1.1e-138

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:sll1103)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>SGL_RS10910 TRAP transporter large permease subunit (Synechocystis sp000284455 PCC 6803)
MVDYDWLGPMMFVGALVFLGCGYPVAFSLGGVAILFAIIGAALGSFDPIFLSAMPQRIFG
IMANGTLLAIPFFIFLGSMLERSGIAEQLLETMGIILGHLRGGLALAVILVGTMLAATTG
VVAATVVAMGLISLPIMLRYGYSKELASGVIVASGTLGQIIPPSVVLIVLADQLGVSVGD
LFIGSLLPGLMMAGSFALYVLIIAWLKPDLAPALPAEVRNIGGQELRRRIVQVMLPPLVL
ILLVLGSIFFGIASPTEAGAVGSIGAIALAHFNQRLNWKALWEVCDATLRITSMVMLILL
GSTAFSLVFRGLEGDRFMFDLLANLPGGQIGFLAISMITIFILGFFIDFFEIAFIVLPLF
KPVAEALNLDLIWYGVIVGANLQTSFLTPPFGFALFYLRGVAPASLTTGQIYRGAVPFIG
LQVLVLLLIIIFPALINWLPSLSVQ