Protein Info for SGL_RS08815 in Synechocystis sp000284455 PCC 6803

Annotation: metal ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00005: ABC_tran" amino acids 28 to 173 (146 residues), 105.9 bits, see alignment E=2.6e-34

Best Hits

Swiss-Prot: 100% identical to MNTA_SYNY3: Manganese transport system ATP-binding protein MntA (mntA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K11603, manganese transport system ATP-binding protein (inferred from 100% identity to syn:sll1599)

Predicted SEED Role

"Manganese ABC transporter, ATP-binding protein SitB" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>SGL_RS08815 metal ABC transporter ATP-binding protein (Synechocystis sp000284455 PCC 6803)
MAATLSRLDISVDGVSVTYNNARLALYNATCTVEPGTITALVGPNGSGKSTLFKSIMGFL
QPSQGRVRIGGFSVQKAQKQQLMAYVPQADEVDWNFPVSVFDVVMMGRYGYMNVLRIPSA
KDRRLVMESLERVGMVKYRDRQIGELSGGQKKRAFLARALAQEGKVILLDEPFTGVDVKT
EKGMIDLLMELRDEGHTILISTHDLASISTFCDHTILLNRTILAQGKTEETFTKENLELT
FGGLPMLSLNQMFESTEVDA