Protein Info for SGL_RS06740 in Synechocystis sp000284455 PCC 6803

Annotation: histidine triad nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF11969: DcpS_C" amino acids 5 to 105 (101 residues), 85.5 bits, see alignment E=3.9e-28 PF01230: HIT" amino acids 12 to 108 (97 residues), 107.4 bits, see alignment E=5.1e-35

Best Hits

Swiss-Prot: 100% identical to YHIT_SYNY3: Uncharacterized HIT-like protein slr1234 (slr1234) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 100% identity to syn:slr1234)

MetaCyc: 50% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Histidine triad (HIT) nucleotide-binding protein, cyanobacterial subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>SGL_RS06740 histidine triad nucleotide-binding protein (Synechocystis sp000284455 PCC 6803)
MAEDTIFSKIIRREIPAAIVYEDDLCLAFKDVNPQAPVHVLLIPKKPLPQLSAATPEDHA
LLGHLLLKAKEVAADLGIGDQFRLVINNGAEVGQTVFHLHLHILGGRPFSWPPG