Protein Info for SGL_RS06590 in Synechocystis sp000284455 PCC 6803

Annotation: nitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 64 to 265 (202 residues), 374.1 bits, see alignment E=7.8e-117 PF00528: BPD_transp_1" amino acids 100 to 267 (168 residues), 106.4 bits, see alignment E=7.8e-35

Best Hits

Swiss-Prot: 100% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to syn:sll1451)

Predicted SEED Role

"Bicarbonate transport system permease protein" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>SGL_RS06590 nitrate ABC transporter permease (Synechocystis sp000284455 PCC 6803)
MASSTAGLRPRRKKNPLSFIYSPKVIRPAVAIAVLLVVWQILCSGEGSNLPSPVQVLEQT
YPLILNPFFDNGGTDKGLGIQIFASLTRVAVGFSAAAVVGIALGILIGSSKFMYDALDPI
FQVLRTIPPLAWLPIALAALQEAEPSAIFVIFITAIWPIVINTTVGAQQVPQDYRNVSRV
LKLSKSQYFFNILFPAAVPYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAYNSSL
ISEIIIALIYVGIVGLLLDRFIAFLESLVVPAEQK