Protein Info for SGL_RS06175 in Synechocystis sp000284455 PCC 6803

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 263 to 284 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 31 to 248 (218 residues), 61.4 bits, see alignment E=1.6e-20 PF09084: NMT1" amino acids 113 to 186 (74 residues), 22.5 bits, see alignment E=2e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 301 to 466 (166 residues), 148.4 bits, see alignment E=8.1e-48 PF00990: GGDEF" amino acids 304 to 462 (159 residues), 173.1 bits, see alignment E=7.9e-55 PF00563: EAL" amino acids 483 to 718 (236 residues), 268.8 bits, see alignment E=7.4e-84

Best Hits

KEGG orthology group: None (inferred from 100% identity to syn:slr2077)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (732 amino acids)

>SGL_RS06175 EAL domain-containing protein (Synechocystis sp000284455 PCC 6803)
MNGIHRWLFRLSIIIQLLWGSAPVTGTQVVRIGVYENQPKIFLNDQNRPVGFWIDVIEAI
AAAENWQIEYHLCEWQACLQKLEAGKIDLMPDVAVNPERAKKFQFNQEVVLNSWSIIYAA
NNANINSIIDLEGKRIVVLKNSVQEKNLIKRLAELKIKAEIIQVDSFSELFKKIDAGEAD
AGAVNYFFGNRFSHQHRVRPTNMVVDTSQLFFAASRQTNPAILRNIDEQVNLLKADTDSI
YYESQKRWLFNNPLLTIQNLRAIIHRLIIIFIIVTVAIVIIWNYRLQKEIKLRKASQNQL
SYQALHDTLTGLANRALLLQRLEFAGHQIKNNPKSRFALLFIDLDHFKLINDSWGHSVGD
ALLIKIAEKLQINLRETDLAVRLGGDEFVIFLESITEIKQAIDVAERILIHLRLPVQIQA
KELFVKASIGIVIGSIHYYEPERLIRDADIAMYQAKNNGRNQYAVFDPSMHQTILERLSL
EHDFRKALEQETLELYYQPIISLVNDRLQGFEALIRWQHPEKGYINPEQLIAIAEETGLI
IILGQWIMQQACQQIAQWREITNDDKIYVSINLSPNQICRPLFVEEIENILQTTKLDGDA
LVLEITEGVLIQHLEIVAECLKKIKSHGIKISIDDFGTGYSSLSYLYRLPVNYLKIDRSF
INQITEDSPSQSIVKTIITLGDLLDIQTVAEGVETNDQLNLLKKMGCGLGQGYFWSEPMT
VREIDCFLDCIV