Protein Info for Rv3101c in Mycobacterium tuberculosis H37Rv

Annotation: Putative cell division protein FtsX (septation component-transport integral membrane protein ABC transporter)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 172 to 197 (26 residues), see Phobius details amino acids 218 to 246 (29 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details PF18075: FtsX_ECD" amino acids 57 to 152 (96 residues), 58.8 bits, see alignment E=6.8e-20 PF02687: FtsX" amino acids 175 to 293 (119 residues), 54.6 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 100% identical to FTSX_MYCTA: Cell division protein FtsX (ftsX) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 99% identity to mbb:BCG_3126c)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>Rv3101c Putative cell division protein FtsX (septation component-transport integral membrane protein ABC transporter) (Mycobacterium tuberculosis H37Rv)
VRFGFLLNEVLTGFRRNVTMTIAMILTTAISVGLFGGGMLVVRLADSSRAIYLDRVESQV
FLTEDVSANDSSCDTTACKALREKIETRSDVKAVRFLNRQQAYDDAIRKFPQFKDVAGKD
SFPASFIVKLENPEQHKDFDTAMKGQPGVLDVLNQKELIDRLFAVLDGLSNAAFAVALVQ
AIGAILLIANMVQVAAYTRRTEIGIMRLVGASRWYTQLPFLVEAMLAATMGVGIAVAGLM
VVRALFLENALNQFYQANLIAKVDYADILFITPWLLLLGVAMSGLTAYLTLRLYVRR